PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019242m
Common NameCARUB_v10019242mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 293aa    MW: 33382.8 Da    PI: 6.233
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019242mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.88.4e-32128186159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+v++s+fpr+YYrCt++ C vkk+vers +dp+ v++tYeg+H+h+
  Carubv10019242m 128 LDDGYKWRKYGQKPVRNSPFPRNYYRCTTTCCDVKKRVERSFSDPSSVITTYEGQHTHP 186
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-31115188IPR003657WRKY domain
SuperFamilySSF1182908.37E-28121188IPR003657WRKY domain
PROSITE profilePS5081130.561123188IPR003657WRKY domain
SMARTSM007743.5E-36128187IPR003657WRKY domain
PfamPF031061.4E-24129186IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MENVGAGVPF YDLGQTRVYP LFSDFNDLSA ERYPVRFMDL LGVHRNALTH TPLMHFPTTT  60
PHSSSSEAVN GDHEKKSEND EEEEEEEEDG EEEQHKTYKR FKITKSIKQT KVKVQKVSFI  120
TKSEVLNLDD GYKWRKYGQK PVRNSPFPRN YYRCTTTCCD VKKRVERSFS DPSSVITTYE  180
GQHTHPRPVL YIPKGDRLGF NGSASRSHLA LPTLPPQLVD YNSHQQQGQS SFGAEYVIRQ  240
EKGSHDHDDH DDDHDDHVVK KSRTRDLLDG AGSVNDDGLL QDVVSSRIIK ED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-251211891078Probable WRKY transcription factor 4
2lex_A9e-251211891078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292965.10.0hypothetical protein CARUB_v10019242mg
SwissprotQ93WV61e-132WRK68_ARATH; Probable WRKY transcription factor 68
TrEMBLR0HPI50.0R0HPI5_9BRAS; Uncharacterized protein
STRINGAT3G62340.11e-129(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150681619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62340.11e-129WRKY family protein